PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g077560.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ARF
Protein Properties Length: 748aa    MW: 81462.8 Da    PI: 7.3884
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g077560.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B376.72.5e-24160261199
                         EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                         f+k+lt sd++++g +++p++ ae++       +  ++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv+ ++L +gD v+F +
  Sopim02g077560.0.1 160 FCKTLTASDTSTHGGFSVPRRAAEDCfapldyrQ--QRPSQELVAKDLHGIEWKFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLR 248
                         99****************************9743..345679************************************************4 PP

                         -SSSEE..EEEEE-S CS
                  B3  85 dgrsefelvvkvfrk 99 
                           + ++el+++v+r+
  Sopim02g077560.0.1 249 --TGDGELRLGVRRA 261
                         ..4788899999986 PP

2Auxin_resp117.31.3e-38286367182
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                         a++ +s++++F+++YnPr s+s+F+v+++k++k+l +++s+GmRfkm++eted++e+r++G+vvgvs++dpvrWp+SkWr+L
  Sopim02g077560.0.1 286 AVNVISSRNAFNICYNPRDSSSDFIVPYHKFSKTLAHPFSAGMRFKMRVETEDAAEQRFTGLVVGVSNVDPVRWPGSKWRCL 367
                         68999****************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.0E-39154266IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.89E-40157264IPR015300DNA-binding pseudobarrel domain
CDDcd100176.77E-21158260No hitNo description
SMARTSM010191.3E-21160262IPR003340B3 DNA binding domain
PfamPF023623.4E-22160261IPR003340B3 DNA binding domain
PROSITE profilePS5086313.507160262IPR003340B3 DNA binding domain
PfamPF065072.0E-33286367IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0010582Biological Processfloral meristem determinacy
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 748 aa     Download sequence    Send to blast
MMCGLIDLNT VDNDDAGEET TAPVSLDSPA SSSAASGSSD LTSSTTPAVA SVCMELWHAC  60
AGPLISLPKK GSAVVYLPQG HLEHLSEYPS IACNLPPHVF CRVVDVKLQA DAATDEVYAQ  120
VSLVPDNQQI EQKWKDGDID ADIEEEEIEG AGKSITPHMF CKTLTASDTS THGGFSVPRR  180
AAEDCFAPLD YRQQRPSQEL VAKDLHGIEW KFRHIYRGQP RRHLLTTGWS AFVNKKKLVS  240
GDAVLFLRTG DGELRLGVRR AAQAKTCSSY LAPCSKPLNV SGIVDAVNVI SSRNAFNICY  300
NPRDSSSDFI VPYHKFSKTL AHPFSAGMRF KMRVETEDAA EQRFTGLVVG VSNVDPVRWP  360
GSKWRCLLVR WDDLDVSRHN RVSPWEIEPS GSAPVPSSLV MPSAKRTRVG FPISKADFPI  420
PREGIAVSDF GEPSRFQKVL QGQEILRMHA PYGGLDARSP RPAGTRCFPG FPSSGISRMG  480
NSIRPLFGDT DKSHESIGFS ESLRFNKVLQ GQEIFTSPPY GRAQAGIQMQ EKSRTGIFVG  540
IQVPNHGNRW PAPNQDNNTP CKPINPVSAS SPPSALNFQH PSPPASKFQA MFNHKHDLVN  600
QASLDLSENC CRYPYLSSGS HTEDISQKEG TQGISSFGFL KEQKQTGLSY LSLGTQSSFK  660
GNQNLVSTCK TGCRIFGFPL TESKISATRA DTPSEAVYSH GLETTFLPSS DGKLQPGPPL  720
MTNVVGTNFT KVNDLYAARD VLLDIAL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A1e-1095139218357Auxin response factor 1
4ldy_B1e-1095139218357Auxin response factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00021PBMTransfer from AT2G33860Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ3402540.0DQ340254.1 Lycopersicon esculentum auxin response factor 3 (ARF3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010315886.10.0PREDICTED: auxin response factor 3 isoform X1
SwissprotO236610.0ARFC_ARATH; Auxin response factor 3
TrEMBLK4B8Y10.0K4B8Y1_SOLLC; Auxin response factor
STRINGSolyc02g077560.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61012333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.10.0ARF family protein